Proteintech, 27789-1-AP, TNC/Tenascin-C Polyclonal antibody

Size: 20ul / 150ul The TNC/Tenascin-C (27789-1-AP) by Proteintech is a Polyclonal antibody targeting TNC/Tenascin-C in WB, IHC, IP, ELISA applications with reactivity to human samples 27789-1-AP targets TNC/Tenascin-C in WB, IHC, IP, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: U-87 MG cells Positive IP detected in: U-87 MG cells Positive IHC detected in: human liver cancer tissue, human breast cancer tissue, human lung cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:500-1:2000 Background Information Tenascin-C (TNC) is a large hexameric extracellular matrix glycoprotein of the tenascin family (PMID: 21818551). It is a multimodular protein containing multiple epidermal growth factor (EGF)-like repeats and fibronectin type III (FN III) domains (PMID: 1719530). Tenascin-C is highly expressed during embryonic development, particularly in the developing central nervous system, around motile cells and at epithelial-mesenchymal interaction sites (PMID: 25738825). In adult tissues, the expression and the distribution of TNC are typically limited under normal physiological conditions. It is upregulated during injury, inflammation, regeneration, and cancer (PMID: 7694605; 25120494). Tenascin-C is a diverse protein that can produce different functions including regulating cell adhesion, migration and proliferation. Specification Tested Reactivity: human Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag27122 Product name: Recombinant human TNC protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 23-200 aa of BC151843 Sequence: GVLKKVIRHKRQSGVNATLPEENQPVVFNHVYNIKLPVGSQCSVDLESASGEKDLAPPSEPSESFQEHTVDGENQIVFTHRINIPRRACGCAAAPDVKELLSRLEELENLVSSLREQCTAGAGCCLQPATGRLDTRPFCSGRGNFSTEGCGCVCEPGWKGPNCSEPECPGNCHLRGRC Predict reactive species Full Name: tenascin C Calculated Molecular Weight: 2201 aa, 241 kDa Observed Molecular Weight: 220-350 kDa, 190-240 kDa GenBank Accession Number: BC151843 Gene Symbol: Tenascin C Gene ID (NCBI): 3371 RRID: AB_2918131 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P24821 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.