Proteintech, 27794-1-AP, Periostin Polyclonal antibody

Size: 20ul / 150ul The Periostin (27794-1-AP) by Proteintech is a Polyclonal antibody targeting Periostin in IHC, ELISA applications with reactivity to human samples 27794-1-AP targets Periostin in IHC, ELISA applications and shows reactivity with human samples. Tested Applications Positive IHC detected in: human colon tissue, human colon cancer tissue, human breast cancer tissue, human liver cancer tissue, human lung cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Immunohistochemistry (IHC): IHC : 1:300-1:1200 Background Information Periostin (POSTN, PN), originally named as osteoblast-specific factor 2 (OSF-2), is a 90-kDa secreted protein which is now classified as a matricellular protein. It is present in a wide variety of normal adult tissues and fetal tissues, and has a role in bone, tooth and heart development and function. Studies show that periostin is overexpressed in a broad range of human cancer types, including lung, ovary, breast and colon cancers. Recent evidence reveals that periostin is expressed by fibroblasts in the normal tissue and in the stroma of the primary tumour, and it is required to allow cancer stem cell maintenance. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag27145 Product name: Recombinant human POSTN protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 473-669 aa of BC106710 Sequence: MEKGSKQGRNGAIHIFREIIKPAEKSLHEKLKQDKRFSTFLSLLEAADLKELLTQPGDWTLFVPTNDAFKGMTSEEKEILIRDKNALQNIILYHLTPGVFIGKGFEPGVTNILKTTQGSKIFLKEVNDTLLVNELKSKESDIMTTNGVIHVVDKLLYPADTPVGNDQLLEILNKLIKYIQIKFVRGSTFKEIPVTVY Predict reactive species Full Name: periostin, osteoblast specific factor GenBank Accession Number: BC106710 Gene Symbol: Periostin Gene ID (NCBI): 10631 RRID: AB_2880975 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q15063 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.