Iright
BRAND / VENDOR: Proteintech

Proteintech, 27796-1-AP, LRRC56 Polyclonal antibody

CATALOG NUMBER: 27796-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The LRRC56 (27796-1-AP) by Proteintech is a Polyclonal antibody targeting LRRC56 in IHC, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 27796-1-AP targets LRRC56 in IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive IHC detected in: mouse brain tissue, rat testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: U-251 cells Recommended dilution Immunohistochemistry (IHC): IHC : 1:200-1:800 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information Leucine-rich repeat (LRR)-containing gene 56 (LRRC56) was recently reported to be a homolog of the Outer Dynein Arm 8 gene (oda8), a gene necessary for the cytoplasmic maturation of the outer dynein arms (ODA) in the flagella of algae. LRRC56 is recruited during axoneme construction in an IFT-dependent manner and is required for the addition of dynein arms to the distal segment of the flagellum. Human LRRC56 encodes a 542 amino acid protein determined from transcriptomic studies and immunohistochemistry to be expressed in many organs, mostly in testis and pituitary gland. Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag22018 Product name: Recombinant human LRRC56 protein Source: e coli. -derived, PET30a Tag: 6*His Domain: 1-318 aa of BC035936 Sequence: MDLGWDRSRGPRRSTSSVRVRELSWQGLHNPCPQSKGPGSQRDRLGEQLVEEYLSPARLQALARVDDLRLVRTLEMCVDTREGSLGNFGVHLPNLDQLKLNGSHLGSLRDLGTSLGHLQVLWLARCGLADLDGIASLPALKELYASYNNISDLSPLCLLEQLEVLDLEGNSVEDLGQVRYLQLCPRLAMLTLEGNLVCLQPAPGPTNKVPRGYNYRAEVRKLIPQLQVLDEVPAAHTGPPAPPRLSQDWLAVKEAIKKGNGLPPLDCPRGAPIRRLDPELSLPETQSRASRPWPFSLLVRGGPLPEGLLSEDLAPEDN Predict reactive species Full Name: leucine rich repeat containing 56 Calculated Molecular Weight: 542 aa, 59 kDa GenBank Accession Number: BC035936 Gene Symbol: LRRC56 Gene ID (NCBI): 115399 RRID: AB_3669624 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q8IYG6 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924