Proteintech, 27805-1-AP, PPP4R1 Polyclonal antibody

Size: 20ul / 150ul The PPP4R1 (27805-1-AP) by Proteintech is a Polyclonal antibody targeting PPP4R1 in WB, IP, IHC, ELISA applications with reactivity to Human samples 27805-1-AP targets PPP4R1 in WB, IP, IF, IHC, ELISA applications and shows reactivity with Human samples. Tested Applications Positive WB detected in: HEK-293T cells, HeLa cells, HEK-293 cells, A431 cells Positive IP detected in: HEK-293T cells Positive IHC detected in: human liver cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:2000-1:16000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:50-1:500 Specification Tested Reactivity: Human Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag26405 Product name: Recombinant human PPP4R1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 331-520 aa of BC060829 Sequence: NRTRDQEAPEDVQVRPEDTPSDLSVSNSSVILENTMEDHAAEASGKPLGEISVPLDSSLLCTLSSESHQEAASNENDKKPGNYKSMLRPEVGTTSQDSALLDQELYNSFHFWRTPLPEIDLDIELEQNSGGKPSPEGPEEESEGPVPSSPNITMATRKELEEMIENLEPHIDDPDVKAQVEVLSAALRAS Predict reactive species Full Name: protein phosphatase 4, regulatory subunit 1 Calculated Molecular Weight: 107 kDa Observed Molecular Weight: 120-130 kDa GenBank Accession Number: BC060829 Gene Symbol: PPP4R1 Gene ID (NCBI): 9989 RRID: AB_2880978 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q8TF05 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.