Iright
BRAND / VENDOR: Proteintech

Proteintech, 27818-1-AP, HAPLN2 Polyclonal antibody

CATALOG NUMBER: 27818-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The HAPLN2 (27818-1-AP) by Proteintech is a Polyclonal antibody targeting HAPLN2 in WB, ELISA applications with reactivity to Human, Rat, Pig samples 27818-1-AP targets HAPLN2 in WB, ELISA applications and shows reactivity with Human, Rat, Pig samples. Tested Applications Positive WB detected in: pig brain tissue, rat brain tissue Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Specification Tested Reactivity: Human, Rat, Pig Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag27169 Product name: Recombinant human HAPLN2 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-120 aa of BC029864 Sequence: MPGWLTLPTLCRFLLWAFTIFHKAQGDPASHPGPHYLLPPIHEVIHSHRGATATLPCVLGTTPPSYKVRWSKVEPGELRETLILITNGLHARGYGPLGGRARMRRGHRLDASLVIAGVRL Predict reactive species Full Name: hyaluronan and proteoglycan link protein 2 Calculated Molecular Weight: 38 kDa Observed Molecular Weight: 35 kDa GenBank Accession Number: BC029864 Gene Symbol: HAPLN2 Gene ID (NCBI): 60484 RRID: AB_2880982 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9GZV7 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924