Iright
BRAND / VENDOR: Proteintech

Proteintech, 27848-1-AP, ABCC6 Polyclonal antibody

CATALOG NUMBER: 27848-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The ABCC6 (27848-1-AP) by Proteintech is a Polyclonal antibody targeting ABCC6 in WB, IHC, ELISA applications with reactivity to Human, Mouse samples 27848-1-AP targets ABCC6 in WB, IF, IHC, ELISA applications and shows reactivity with Human, Mouse samples. Tested Applications Positive WB detected in: mouse liver tissue Positive IHC detected in: mouse liver tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information The ATP-binding cassette transporter 6 (ABCC6) gene, also named as MRP6, is a cellular transmembrane protein transporter and belongs to ATP-binding cassette (ABC) family. ABCC6 is an ATP-dependent transporter contains two ATP-binding domains. It is mainly found in the liver, the proximal tubules of the kidneys and the intestines. ABCC6 is involved in a pathway of extracellular nucleotide metabolism and the regulation of tissue calcification. Mutations of ABCC6 leads to pseudoxanthoma elasticum (PXE) which is a rare autosomal recessive disorder. Mutations of ABCC6 can also lead generalized arterial calcification of infancy-2 (GACI2). 27848-1-AP detects two isoforms of ABCC6 protein around 165 kDa and 96 kDa in SDS-PAGE.(PMID:28891970, 29709427, 29662086, 15888484) Specification Tested Reactivity: Human, Mouse Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag18640 Product name: Recombinant human ABCC6 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1219-1503 aa of BC131732 Sequence: VVRNWTDLENSIVSVERMQDYAWTPKEAPWRLPTCAAQPPWPQGGQIEFRDFGLRYRPELPLAVQGVSFKIHAGEKVGIVGRTGAGKSSLASGLLRLQEAAEGGIWIDGVPIAHVGLHTLRSRISIIPQDPILFPGSLRMNLDLLQEHSDEAIWAALETVQLKALVASLPGQLQYKCADRGEDLSVGQKQLLCLARALLRKTQILILDEATAAVDPGTELQMQAMLGSWFAQCTVLLIAHRLRSVMDCARVLVMDKGQVAESGSPAQLLAQKGLFYRLAQESGLV Predict reactive species Full Name: ATP-binding cassette, sub-family C (CFTR/MRP), member 6 Calculated Molecular Weight: 1503 aa, 165 kDa Observed Molecular Weight: 165 kDa and 96 kDa GenBank Accession Number: BC131732 Gene Symbol: ABCC6 Gene ID (NCBI): 368 RRID: AB_2880992 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O95255 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924