Iright
BRAND / VENDOR: Proteintech

Proteintech, 27856-1-AP, YME1L1 Polyclonal antibody

CATALOG NUMBER: 27856-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The YME1L1 (27856-1-AP) by Proteintech is a Polyclonal antibody targeting YME1L1 in WB, IHC, IF/ICC, ELISA applications with reactivity to Human, mouse samples 27856-1-AP targets YME1L1 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with Human, mouse samples. Tested Applications Positive WB detected in: HeLa cells, Jurkat cells, MCF-7 cells Positive IHC detected in: mouse liver tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information YME1L1(ATP-dependent zinc metalloprotease) is also named as FTSH1, YME1L,Meg-4,PAMP. YME1L1 plays a phylogenetically conserved role in mitochondrial protein metabolism.It also ensures cell proliferation, maintains normal cristae morphology and complex I respiration activity, promotes antiapoptotic activity and protects mitochondria from the accumulation of oxidatively damaged membrane proteins. YME1L1 can prevent mitochondrial DNA inserting into nuclear. It has 3 isoforms produced by alternative splicing with the molecular weight of 86 kDa, 80 kDa and 76 kDa. This protein can migrate with a molecular weight of about 55-63 kDa, which is the size of the mature YME1L1 protein(PMID:22252130; 22354088). Specification Tested Reactivity: Human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag27280 Product name: Recombinant human YME1L1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 40-239 aa of BC023507 Sequence: QNQHRDVVPEHEAPSSEPSLNLRDLGLSELKIGQIDQLVENLLPGFCKGKNISSHWHTSHVSAQSFFENKYGNLDIFSTLRSSCLYRHHSRALQSICSDLQYWPVFIQSRGFKTLKSRTRRLQSTSERLAETQNIAPSFVKGFLLRDRGSDVESLDKLMKTKNIPEAHQDAFKTGFAEGFLKAQALTQKTNDSLRRTRLI Predict reactive species Full Name: YME1-like 1 (S. cerevisiae) Calculated Molecular Weight: 716 aa, 80 kDa Observed Molecular Weight: 63 kDa GenBank Accession Number: BC023507 Gene Symbol: YME1L1 Gene ID (NCBI): 10730 RRID: AB_3085999 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q96TA2 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924