Proteintech, 27872-1-AP, Gamma Catenin Polyclonal antibody

Size: 20ul / 150ul The Gamma Catenin (27872-1-AP) by Proteintech is a Polyclonal antibody targeting Gamma Catenin in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 27872-1-AP targets Gamma Catenin in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HT-29 cells, HUVEC cells, T-47D cells, mouse heart tissue, MCF-7 cells, rat heart tissue Positive IHC detected in: human breast cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: MCF-7 cells, HeLa cells, A431 cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunohistochemistry (IHC): IHC : 1:2000-1:8000 Immunofluorescence (IF)/ICC: IF/ICC : 1:500-1:2000 Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag27394 Product name: Recombinant human JUP protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 669-745 aa of BC000441 Sequence: TNSLFKHDPAAWEAAQSMIPINEPYGDDMDATYRPMYSSDVPLDPLEMHMDMDGDYPIDTYSDGLRPPYPTADHMLA Predict reactive species Full Name: junction plakoglobin Observed Molecular Weight: 82 kDa GenBank Accession Number: BC000441 Gene Symbol: Gamma Catenin Gene ID (NCBI): 3728 RRID: AB_2881000 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P14923 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.