Iright
BRAND / VENDOR: Proteintech

Proteintech, 27887-1-AP, PRRC1 Polyclonal antibody

CATALOG NUMBER: 27887-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The PRRC1 (27887-1-AP) by Proteintech is a Polyclonal antibody targeting PRRC1 in WB, IHC, ELISA applications with reactivity to Human, Mouse samples 27887-1-AP targets PRRC1 in WB, IHC, ELISA applications and shows reactivity with Human, Mouse samples. Tested Applications Positive WB detected in: HeLa cells, mouse heart tissue Positive IHC detected in: human pancreas tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:3000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Specification Tested Reactivity: Human, Mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag27349 Product name: Recombinant human PRRC1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 191-356 aa of BC017066 Sequence: FPEEQEDPRITRGQDEASAGGIWGFIKGVAGNPMVKSVLDKTKHSVESMITTLDPGMAPYIKSGGELDIVVTSNKEVKVAAVRDAFQEVFGLAVVVGEAGQSNIAPQPVGYAAGLKGAQERIDSLRRTGVIHEKQTAVSVENFIAELLPDKWFDIGCLVVEDPVHG Predict reactive species Full Name: proline-rich coiled-coil 1 Calculated Molecular Weight: 445 aa, 47 kDa Observed Molecular Weight: 50 kDa GenBank Accession Number: BC017066 Gene Symbol: PRRC1 Gene ID (NCBI): 133619 RRID: AB_2881005 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q96M27 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924