Iright
BRAND / VENDOR: Proteintech

Proteintech, 27941-1-AP, PTPRD Polyclonal antibody

CATALOG NUMBER: 27941-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The PTPRD (27941-1-AP) by Proteintech is a Polyclonal antibody targeting PTPRD in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 27941-1-AP targets PTPRD in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HuH-7 cells, human placenta tissue, mouse liver tissue, rat liver tissue Positive IHC detected in: human liver tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:1000-1:5000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information PTPRD is a receptor-type protein tyrosine phosphatase that plays significant roles in various biological processes, including cell adhesion, synaptic function, and signal transduction. PTPRD is highly expressed in the brain, followed by the kidney, ovary, placenta, and intestine. Within the brain, it is found in specific regions, suggesting a role in neurological functions. PTPRD has emerged as a potential therapeutic target for various brain phenotypes and disorders. Its genetic variations have been associated with nervous system phenotypes, and the discovery of the first small molecule inhibitor of PTPRD phosphatase has opened new avenues for therapeutic intervention in addiction and possibly other PTPRD-associated disorders. Additionally, PTPRD is considered a tumor-suppressor gene that is down-regulated in hepatocellular carcinoma, suggesting its role in cancer progression and potential as a therapeutic target. The protein can recognize 175 kDa full length and 75 kDa mature cleavage product (PMID: 19074898, PMID: 25113440). Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag27689 Product name: Recombinant human PTPRD protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1089-1225 aa of BC106714 Sequence: GNSAGGLQHRVTAKTAPDVLRTKPAFIGKTNLDGMITVQLPEVPANENIKGYYIIIVPLKKSRGKFIKPWESPDEMELDELLKEISRKRRSIRYGREVELKPYIAAHFDVLPTEFTLGDDKHYGGFTNKQLQSGQEY Predict reactive species Full Name: protein tyrosine phosphatase, receptor type, D Calculated Molecular Weight: 1912 aa, 215 kDa Observed Molecular Weight: 75 kDa, 175 kDa GenBank Accession Number: BC106714 Gene Symbol: PTPRD Gene ID (NCBI): 5789 RRID: AB_3086013 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P23468 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924