Iright
BRAND / VENDOR: Proteintech

Proteintech, 27973-1-AP, ALKBH1 Polyclonal antibody

CATALOG NUMBER: 27973-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The ALKBH1 (27973-1-AP) by Proteintech is a Polyclonal antibody targeting ALKBH1 in WB, ELISA applications with reactivity to Human samples 27973-1-AP targets ALKBH1 in WB, ELISA applications and shows reactivity with Human samples. Tested Applications Positive WB detected in: A549 cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Background Information Two RNA m6A demethylases, FTO and ALKBH5, have been identified since 2011, with both capable of removing the methyl group of m6A on poly-adenylated RNA through an iron-dependent oxidative demethylation mechanism. ALKBH1 as a RNA demethylase that mediates removal of the methyl group from N1-methyladenosine (m1A) in tRNA. ALKBH1 can tune translation initiation and elongation by regulating the cellular levels of tRNAiMet and the association of other ALKBH1 target tRNAs to polysomes, thereby affecting protein synthesis. Specification Tested Reactivity: Human Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag27520 Product name: Recombinant human ALKBH1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 15-169 aa of BC025787 Sequence: ATEPGEDAFRKLFRFYRQSRPGTADLEGVIDFSAAHAARGKGPGAQKVIKSQLNVSSVSEQNAYRAGLQPVSKWQAYGLKGYPGFIFIPNPFLPGYQWHWVKQCLKLYSQKPNVCNLDKHMSKEETQDLWEQSKEFLRYKEATKRRPRSLLEKLR Predict reactive species Full Name: alkB, alkylation repair homolog 1 (E. coli) Calculated Molecular Weight: 389 aa, 44 kDa Observed Molecular Weight: 40-45 kDa GenBank Accession Number: BC025787 Gene Symbol: ALKBH1 Gene ID (NCBI): 8846 RRID: AB_2881025 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q13686 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924