Iright
BRAND / VENDOR: Proteintech

Proteintech, 27975-1-AP, ZBTB24 Polyclonal antibody

CATALOG NUMBER: 27975-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The ZBTB24 (27975-1-AP) by Proteintech is a Polyclonal antibody targeting ZBTB24 in WB, ELISA applications with reactivity to Human samples 27975-1-AP targets ZBTB24 in WB, IP, ELISA applications and shows reactivity with Human samples. Tested Applications Positive WB detected in: HeLa cells, Jurkat cells Recommended dilution Western Blot (WB): WB : 1:500-1:3000 Specification Tested Reactivity: Human Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag24458 Product name: Recombinant human ZBTB24 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 151-333 aa of BC036731 Sequence: SNKKNDPPKRKRGRPKKVNTLQEEKSELAAEEEIQLRVNNSVQNRQNFVVKGDSGVLNEQIAAKEKEESEPTCEPSREEEMPVEKDENYDPKTEDGQASQSRYSKRRIWRSVKLKDYKLVGDQEDHGSAKRICGRRKRPGGPEARCKDCGKVFKYNHFLAIHQRSHTGNDVFKADCSVLQNWE Predict reactive species Full Name: zinc finger and BTB domain containing 24 Calculated Molecular Weight: 697 aa, 78 kDa Observed Molecular Weight: 80-85 kDa GenBank Accession Number: BC036731 Gene Symbol: ZBTB24 Gene ID (NCBI): 9841 RRID: AB_2881026 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O43167 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924