Iright
BRAND / VENDOR: Proteintech

Proteintech, 27976-1-AP, PPP1R17 Polyclonal antibody

CATALOG NUMBER: 27976-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The PPP1R17 (27976-1-AP) by Proteintech is a Polyclonal antibody targeting PPP1R17 in WB, IF/ICC, ELISA applications with reactivity to Human, mouse, rat samples 27976-1-AP targets PPP1R17 in WB, IF/ICC, ELISA applications and shows reactivity with Human, mouse, rat samples. Tested Applications Positive WB detected in: mouse cerebellum tissue, rat cerebellum tissue Positive IF/ICC detected in: U2OS cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information PPP1R17, an endogenous substrate for cGMP-dependent protein kinase, exists almost exclusively in cerebellar Purkinje cells, where it is possibly involved in the induction of long-term depression (PMID: 10051666). PPP1R17 inhibits phosphatase activities of protein phosphatase 1 (PP1) and protein phosphatase 2A (PP2A) complexes. Allelic variants increase susceptibility to hypercholesterolemia (PMID: 12955585). Specification Tested Reactivity: Human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag15187 Product name: Recombinant human C7orf16 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-155 aa of BC028094 Sequence: MMSTEQMQPLEVSEDRLDKLDPRCSHLDDLSDQFIKDCDLKKKPRKGKNVQATLNVESDQKKPRRKDTPALHIPPFIPGVFSEHLIKRYDVQERHPKGKMIPVLHNTDLEQKKPRRKDTPALHMSPFAAGVTLLRDERPKAIVEDDEKDGDKIAI Predict reactive species Full Name: chromosome 7 open reading frame 16 Calculated Molecular Weight: 155 aa, 18 kDa Observed Molecular Weight: 20-30 kDa GenBank Accession Number: BC028094 Gene Symbol: PPP1R17 Gene ID (NCBI): 10842 RRID: AB_3086018 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O96001 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924