Iright
BRAND / VENDOR: Proteintech

Proteintech, 27980-1-AP, ANK3 Polyclonal antibody

CATALOG NUMBER: 27980-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The ANK3 (27980-1-AP) by Proteintech is a Polyclonal antibody targeting ANK3 in WB, IHC, IF/ICC, ELISA applications with reactivity to Human, Mouse, Rat samples 27980-1-AP targets ANK3 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with Human, Mouse, Rat samples. Tested Applications Positive WB detected in: mouse brain tissue, rat brain tissue Positive IHC detected in: human breast cancer tissue, mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: PC-3 cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information ANK3 is associated with neurodevelopment and neuronal function. It has been reported that ANK3 plays a key role in bipolar disorder. ANK3 is expressed in brain at a high level. There are several isoforms of ANK3 associated with different tissue expression and function. The immune region we selected can recognize 480 kDa, 204 kDa, 202 kDa and 111 kDa protein and 27980-1-AP detects 204 kDa isoform in SDS-PAGE. (PMID: 27217151, 28687526, 30297702, 28109561, 30046097) Specification Tested Reactivity: Human, Mouse, Rat Cited Reactivity: human, zebrafish Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag27635 Product name: Recombinant human ANK3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 4221-4377 aa of NM_001149 Sequence: MGLLDRLDDSPDQCRDSITSYLKGEAGKFEANGSHTEITPEAKTKSYFPESQNDVGKQSTKETLKPKIHGSGHVEEPASPLAAYQKSLEETSKLIIEETKPCVPVSMKKMSRTSPADGKPRLSLHEEEGSSGSEQKQGEGFKVKTKKEIRHVEKKSHS Predict reactive species Full Name: ankyrin 3, node of Ranvier (ankyrin G) Calculated Molecular Weight: 480 kDa Observed Molecular Weight: 160 kDa, 204 kDa GenBank Accession Number: NM_001149 Gene Symbol: ANK3 Gene ID (NCBI): 288 RRID: AB_2881028 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q12955 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924