Proteintech, 27984-1-AP, FAM71F1 Polyclonal antibody

Size: 20ul / 150ul The FAM71F1 (27984-1-AP) by Proteintech is a Polyclonal antibody targeting FAM71F1 in WB, ELISA applications with reactivity to Human samples 27984-1-AP targets FAM71F1 in WB, ELISA applications and shows reactivity with Human samples. Tested Applications Positive WB detected in: A549 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:8000 Background Information FAM71F1, also named GARIN1B and FAM137A, belongs to the GARIN family. FAM71F1 is a testis-enriched protein containing a RAB2B-binding domain, a small GTPase involved in vesicle transport and membrane trafficking (PMID: 34714330). Specification Tested Reactivity: Human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag16525 Product name: Recombinant human FAM71F1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 220-342 aa of BC037248 Sequence: NCSSPSGDSKLVQKKLQASQPSESLIQLMTKGESEALSQIFADLHQQNQLRSSRKVETNKNSSGKDSSREDSIPCTCDLRWRASFTYGEWERENPSGLQPLSLLSTLAASTGPQLAPPIGNSI Predict reactive species Full Name: family with sequence similarity 71, member F1 Calculated Molecular Weight: 342 aa, 39 kDa Observed Molecular Weight: 40 kDa GenBank Accession Number: BC037248 Gene Symbol: FAM71F1 Gene ID (NCBI): 84691 RRID: AB_2881030 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q96KD3 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.