Proteintech, 28016-1-AP, BPTF Polyclonal antibody

Size: 20ul / 150ul The BPTF (28016-1-AP) by Proteintech is a Polyclonal antibody targeting BPTF in IHC, IF/ICC, ELISA applications with reactivity to human samples 28016-1-AP targets BPTF in IHC, IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive IHC detected in: human breast cancer tissue, human colon cancer tissue, human liver cancer tissue, human ovary tumor tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HepG2 cells Recommended dilution Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information Bromodomain PHD finger transcription factor (BPTF), a histone-binding component of NURF (nucleosome-remodeling factor), plays an important role in catalyzing ATP-dependent nucleosome sliding and facilitating transcription of chromatin. It has been reported that BPTF maybe a novel and potential therapeutic target in hepatocellular carcinoma. BPTF may also regulate transcription through direct binding to DNA or transcription factors.(PMID: 30419422) Specification Tested Reactivity: human Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag27761 Product name: Recombinant human BPTF protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 459-657 aa of NM_004459 Sequence: MEPIGYDRSRRKYWFLNRRLIIEEDTENENEKKIWYYSTKVQLAELIDCLDKDYWEAELCKILEEMREEIHRHMDITEDLTNKARGSNKSFLAAANEEILESIRAKKGDIDNVKSPEETEKDKNETENDSKDAEKNREEFEDQSLEKDSDDKTPDDDPEQGKSEEPTEVGDKGNSVSANLGDNTTNATSEETSPSEGRSP Predict reactive species Full Name: bromodomain PHD finger transcription factor Calculated Molecular Weight: 338 kDa GenBank Accession Number: NM_004459 Gene Symbol: BPTF Gene ID (NCBI): 2186 RRID: AB_2918139 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q12830 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.