Proteintech, 28021-1-AP, ATG14/Barkor Polyclonal antibody

Size: 20ul / 150ul The ATG14/Barkor (28021-1-AP) by Proteintech is a Polyclonal antibody targeting ATG14/Barkor in WB, IP, IHC, ELISA applications with reactivity to Human, Mouse, Rat samples 28021-1-AP targets ATG14/Barkor in WB, IHC, IP, ELISA applications and shows reactivity with Human, Mouse, Rat samples. Tested Applications Positive WB detected in: mouse brain tissue, A549 cells, rat brain tissue Positive IP detected in: rat brain tissue Positive IHC detected in: human liver cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:200-1:800 Background Information ATG14 plays a critical role in autophagy which is required for both basal and inducible autophagy. It has been reported that the loss of ATG14 completely blocks autophagic fusion with lysosomes. ATG14 is associated with the location of PI3-kinase complex PI3KC3-C1 and the formation of autophagosome. Besides, BECN2 can form the BECN2:ATG14 heterodimer with ATG14. 28021-1-AP antibody recognizes the 55 kDa protein and the phosphorylated 65 kDa protein in SDS-PAGE. (PMID: 28218432, 24597603, 30894050) Specification Tested Reactivity: Human, Mouse, Rat Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag27671 Product name: Recombinant human ATG14 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-198 aa of NM_014924 Sequence: MASPSGKGARALEAPGCGPRPLARDLVDSVDDAEGLYVAVERCPLCNTTRRRLTCAKCVQSGDFVYFDGRDRERFIDKKERLSRLKSKQEEFQKEVLKAMEGKWITDQLRWKIMSCKMRIEQLKQTICKGNEEMEKNSEGLLKTKEKNQKLYSRAQRHQEKKEKIQRHNRKLGDLVEKKTIDLRSHYERLANLRRSHI Predict reactive species Full Name: KIAA0831 Calculated Molecular Weight: 55 kDa Observed Molecular Weight: 55 and 65 kDa GenBank Accession Number: NM_014924 Gene Symbol: ATG14 Gene ID (NCBI): 22863 RRID: AB_2881038 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q6ZNE5 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.