Proteintech, 28025-1-AP, NDUFAF7 Polyclonal antibody

Size: 20ul / 150ul The NDUFAF7 (28025-1-AP) by Proteintech is a Polyclonal antibody targeting NDUFAF7 in WB, ELISA applications with reactivity to Mouse, Rat, human samples 28025-1-AP targets NDUFAF7 in WB, ELISA applications and shows reactivity with Mouse, Rat, human samples. Tested Applications Positive WB detected in: mouse heart tissue, rat heart tissue Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Specification Tested Reactivity: Mouse, Rat, human Cited Reactivity: mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag27590 Product name: Recombinant human C2orf56 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 264-425 aa of BC004548 Sequence: QHDETRDHVEVCPDAGVIIEELSQRIALTGGAALVADYGHDGTKTDTFRGFCDHKLHDVLIAPGTADLTADVDFSYLRRMAQGKVASLGPIKQHTFLKNMGIDVRLKVLLDKSNEPSVRQQLLQGYDMLMNPKKMGERFNFFALLPHQRLQGGRYQRNARQS Predict reactive species Full Name: chromosome 2 open reading frame 56 Calculated Molecular Weight: 441 aa, 49 kDa Observed Molecular Weight: 50 kDa GenBank Accession Number: BC004548 Gene Symbol: NDUFAF7 Gene ID (NCBI): 55471 RRID: AB_2881039 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q7L592 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.