Iright
BRAND / VENDOR: Proteintech

Proteintech, 28035-1-AP, IL-33 Polyclonal antibody

CATALOG NUMBER: 28035-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The IL-33 (28035-1-AP) by Proteintech is a Polyclonal antibody targeting IL-33 in WB, IHC, ELISA applications with reactivity to mouse, rat samples 28035-1-AP targets IL-33 in WB, IHC, ELISA applications and shows reactivity with mouse, rat samples. Tested Applications Positive WB detected in: mouse lung tissue, mouse colon tissue, rat lung tissue Positive IHC detected in: mouse spleen tissue, mouse lung tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:200-1:800 Background Information Interleukin-33 (IL-33) is a tissue-derived nuclear cytokine from the IL-1 family abundantly expressed in endothelial cells, epithelial cells and fibroblast-like cells, both during homeostasis and inflammation. IL-33 activates many immune cell types involved in type-2 immunity and allergic inflammation, including ILC2s, mast cells, Th2 cells, eosinophils, basophils, dendritic cells and alternatively activated macrophages (AAM). As a cytokine, IL-33 interacts with the receptors ST2 (also known as IL1RL1) and IL-1 Receptor Accessory Protein (IL1RAP), activating intracellular molecules in the NF-κB and MAP kinase signaling pathways that drive production of type 2 cytokines (e.g. IL-5 and IL-13) from polarized Th2 cells. IL-33 is also effective in reversing Alzheimer-like symptoms in APP/PS1 mice, by reversing the buildup and preventing the new formation of amyloid plaques. IL-33 is synthesized as a 30-34 kD full-length form and 20 kDa form mature form. Specification Tested Reactivity: mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag27846 Product name: Recombinant mouse IL-33 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 109-266 aa of NM_001164724 Sequence: MSIQGTSLLTQSPASLSTYNDQSVSFVLENGCYVINVDDSGKDQEQDQVLLRYYESPCPASQSGDGVDGKKLMVNMSPIKDTDIWLHANDKDYSVELQRGDVSPPEQAFFVLHKKSSDFVSFECKNLPGTYIGVKDNQLALVEEKDESCNNIMFKLSKI Predict reactive species Full Name: interleukin 33 Calculated Molecular Weight: 30 kDa Observed Molecular Weight: 30-35 kDa GenBank Accession Number: NM_001164724 Gene Symbol: IL-33 Gene ID (NCBI): 77125 RRID: AB_2881042 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q8BVZ5 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924