Product Description
Size: 20ul / 150ul
The TMUB2 (28044-1-AP) by Proteintech is a Polyclonal antibody targeting TMUB2 in WB, ELISA applications with reactivity to Human samples
28044-1-AP targets TMUB2 in WB, ELISA applications and shows reactivity with Human samples.
Tested Applications
Positive WB detected in: A549 cells
Recommended dilution
Western Blot (WB): WB : 1:200-1:1000
Specification
Tested Reactivity: Human
Cited Reactivity: human
Host / Isotype: Rabbit / IgG
Class: Polyclonal
Type: Antibody
Immunogen: CatNo: Ag27691 Product name: Recombinant human TMUB2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 101-230 aa of BC063489 Sequence: HPSEGNDEKAEEAGEGRGDSTGEAGAGGGVEPSLEHLLDIQGLPKRQAGAGSSSPEAPLRSEDSTCLPPSPGLITVRLKFLNDTEELAVARPEDTVGALKSKYFPGQESQMKLIYQGRLLQDPARTLRSL Predict reactive species
Full Name: transmembrane and ubiquitin-like domain containing 2
Observed Molecular Weight: 33 kDa
GenBank Accession Number: BC063489
Gene Symbol: TMUB2
Gene ID (NCBI): 79089
RRID: AB_2881045
Conjugate: Unconjugated
Form: Liquid
Purification Method: Antigen affinity purification
UNIPROT ID: Q71RG4
Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.
Order Guidelines
1. Price & Stock Available on Request. Click to send email to: service@iright.com
2. Please DO NOT make payment before confirmation.
3. Minimum order value of $1,000 USD required.
Collaboration
Tony Tang
Email: Tony.Tang@iright.com
Mobile/WhatsApp/Wechat: +86-17717886924