Iright
BRAND / VENDOR: Proteintech

Proteintech, 28050-1-AP, KPNA3 Polyclonal antibody

CATALOG NUMBER: 28050-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The KPNA3 (28050-1-AP) by Proteintech is a Polyclonal antibody targeting KPNA3 in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse samples 28050-1-AP targets KPNA3 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: HepG2 cells Positive IHC detected in: mouse brain tissue, human brown diseaseNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HepG2 cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information KPNA3, karyopherin subunit alpha 3, also known as SRP1 or IPOA4. It is expected to be located in cytoplasm and nucleus, the protein is ubiquitous and highly expressed in heart, skeletal muscle. The calculated molecular weight of KPNA3 is 57 kDa. Functions in nuclear protein import as an adapter protein for nuclear receptor KPNB1. Binds specifically and directly to substrates containing either a simple or bipartite NLS motif. Docking of the importin/substrate complex to the nuclear pore complex (NPC) is mediated by KPNB1 through binding to nucleoporin FxFG repeats and the complex is subsequently translocated through the pore by an energy requiring, Ran-dependent mechanism. At the nucleoplasmic side of the NPC, Ran binds to importin-beta and the three components separate and importin-alpha and -beta are re-exported from the nucleus to the cytoplasm where GTP hydrolysis releases Ran from importin. Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag27755 Product name: Recombinant human KPNA3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 322-453 aa of BC017355 Sequence: VLNCDVLSHFPNLLSHPKEKINKEAVWFLSNITAGNQQQVQAVIDAGLIPMIIHQLAKGDFGTQKEAAWAISNLTISGRKDQVEYLVQQNVIPPFCNLLSVKDSQVVQVVLDGLKNILIMAGDEASTIAEII Predict reactive species Full Name: karyopherin alpha 3 (importin alpha 4) Calculated Molecular Weight: 58 kDa Observed Molecular Weight: 57-60 kDa GenBank Accession Number: BC017355 Gene Symbol: KPNA3 Gene ID (NCBI): 3839 RRID: AB_3086026 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O00505 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924