Iright
BRAND / VENDOR: Proteintech

Proteintech, 28057-1-AP, LRRC2 Polyclonal antibody

CATALOG NUMBER: 28057-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The LRRC2 (28057-1-AP) by Proteintech is a Polyclonal antibody targeting LRRC2 in WB, IHC, ELISA applications with reactivity to mouse, rat, mouse samples 28057-1-AP targets LRRC2 in WB, IHC, ELISA applications and shows reactivity with mouse, rat, mouse samples. Tested Applications Positive WB detected in: mouse heart tissue, mouse skeletal muscle tissue, rat skeletal muscle tissue Positive IHC detected in: mouse skeletal muscle tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information Leucine Rich Repeat Containing 2 (LRRC2) was found to be localized to the mitochondria in human cells and transcriptionally regulated by the mitochondrial master regulator Pgc-1α. It has been reported that Lrrc2 transcript abundance correlates with that of β-MHC, a canonical marker of cardiac hypertrophy in humans, and experimentally demonstrated an elevation in Lrrc2 transcript in vitro and in vivo rodent models of cardiac hypertrophy as well as in patients with dilated cardiomyopathy. (PMID: 28158196) Specification Tested Reactivity: mouse, rat, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag27830 Product name: Recombinant human LRRC2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 18-200 aa of BC029118 Sequence: ETRVKKHKAWQKKEVERLEKSALEKIKEEWNFVAECRRKGIPQAVYCKNGFIDTSVRLLDKIERNTLTRQSSLPKDRGKRSSAFVFELSGEHWTELPDSLKEQTHLREWYISNTLIQIIPTYIQLFQAMRILDLPKNQISHLPAEIGCLKNLKELNVGFNYLKSIPPELGDCENLERLDCSGN Predict reactive species Full Name: leucine rich repeat containing 2 Calculated Molecular Weight: 371 aa, 43 kDa Observed Molecular Weight: 38 kDa GenBank Accession Number: BC029118 Gene Symbol: LRRC2 Gene ID (NCBI): 79442 RRID: AB_3669639 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9BYS8 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924