Iright
BRAND / VENDOR: Proteintech

Proteintech, 28074-1-AP, Ki-67 Polyclonal antibody

CATALOG NUMBER: 28074-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The Ki-67 (28074-1-AP) by Proteintech is a Polyclonal antibody targeting Ki-67 in IHC, IF/ICC, IF-P, IF-Fro, FC (Intra), ELISA applications with reactivity to mouse samples 28074-1-AP targets Ki-67 in WB, IHC, IF/ICC, IF-P, IF-Fro, FC (Intra), ELISA, Cell treatment applications and shows reactivity with mouse samples. Tested Applications Positive IHC detected in: mouse spleen tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-P detected in: mouse colon tissue, mouse spleen tissue Positive IF-Fro detected in: mouse spleen tissue, mouse liver tissue Positive IF/ICC detected in: NIH/3T3 cells Positive FC (Intra) detected in: NIH/3T3 cells Recommended dilution Immunohistochemistry (IHC): IHC : 1:1000-1:4000 Immunofluorescence (IF)-P: IF-P : 1:1500-1:6000 Immunofluorescence (IF)-FRO: IF-FRO : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:400-1:1600 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.20 ug per 10^6 cells in a 100 µl suspension Background Information The Ki-67 protein (also known as MKI67) is a cellular marker for proliferation. Ki67 is present during all active phases of the cell cycle (G1, S, G2 and M), but is absent in resting cells (G0). Cellular content of Ki-67 protein markedly increases during cell progression through S phase of the cell cycle. Therefore, the nuclear expression of Ki67 can be evaluated to assess tumor proliferation by immunohistochemistry. Specification Tested Reactivity: mouse Cited Reactivity: mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag27894 Product name: Recombinant mouse ki67 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 2777-3005 aa of NM_001081117 Sequence: MFQSSPRRPRTRRGKVEADEEPSAVRKTVSTSRQTMRSRKVPEIGNNGTQVSKASIKQTLDTVAKVTGSRRQLRTHKDGVQPLEVLGDSKEITQISDHSEKLAHDTSILKSTQQQKPDSVKPLRTCRRVLRASKEDPKEVLVDTRDHATLQSKSNPLLSPKRKSARDGSIVRTRALRSLAPKQEATDEKPVPEKKRAASSKRHVSPEPVKMKHLKIVSNKLESVEEQVST Predict reactive species Full Name: antigen identified by monoclonal antibody Ki 67 Calculated Molecular Weight: 351 kDa GenBank Accession Number: NM_001081117 Gene Symbol: ki67 Gene ID (NCBI): 17345 RRID: AB_2918145 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: E9PVX6 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924