Proteintech, 28079-1-AP, SCN1A Polyclonal antibody

Size: 20ul / 150ul The SCN1A (28079-1-AP) by Proteintech is a Polyclonal antibody targeting SCN1A in WB, ELISA applications with reactivity to human, mouse, rat samples 28079-1-AP targets SCN1A in WB, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse brain tissue, rat brain tissue, PC-12 cells Recommended dilution Western Blot (WB): WB : 1:500-1:4000 Background Information Sodium channel protein type 1 subunit alpha (SCN1A) is a multi-pass membrane protein that is crucial for generating and transmitting electrical signals in neurons, thereby contributing to the sensory perception of mechanically-induced pain (PMID: 14672992). SCN1A also regulates neuronal excitability and is essential for normal brain function (PMID: 37139072; 20831750). Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag25942 Product name: Recombinant human SCN1A protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 456-522 aa of NM_001165963 Sequence: MEAAQQAATATASEHSREPSAAGRLSDSSSEASKLSSKSAKERRNRRKKRKQKEQSGGEEKDEDEFQK Predict reactive species Full Name: sodium channel, voltage-gated, type I, alpha subunit Calculated Molecular Weight: 229 kDa Observed Molecular Weight: 229-240 kDa GenBank Accession Number: NM_001165963 Gene Symbol: SCN1A Gene ID (NCBI): 6323 RRID: AB_2881054 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P35498 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.