Proteintech, 28081-1-AP, CYP26A1 Polyclonal antibody

Size: 20ul / 150ul The CYP26A1 (28081-1-AP) by Proteintech is a Polyclonal antibody targeting CYP26A1 in WB, IHC, IF-P, ELISA applications with reactivity to human, mouse samples 28081-1-AP targets CYP26A1 in WB, IHC, IF-P, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: human placenta tissue Positive IHC detected in: human placenta tissue, mouse skeletal muscle tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-P detected in: human placenta tissue Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)-P: IF-P : 1:50-1:500 Background Information CYP26A1 (Cytochrome P450 Family 26 Subfamily A Member 1), also known as Cytochrome P450 26A1, CP26, CYP26, P450RAI, and P450RAI1, is a member of the cytochrome P450 superfamily of enzymes, involved in retinoic acid (RA) metabolism and synthesis of cholesterol, steroids, and other lipids. CYP26A1 is essential for normal hindbrain patterning, vertebral identity, and development of posterior structures(PMID: 11157778). Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag24898 Product name: Recombinant human CYP26A1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 110-220 aa of BC157063 Sequence: VHWPASVRTILGSGCLSNLHDSSHKQRKKVIMRAFSREALECYVPVITEEVGSSLEQWLSCGERGLLVYPEVKRLMFRIAMRILLGCEPQLAGDGDSEQQLVEAFEEMTRN Predict reactive species Full Name: cytochrome P450, family 26, subfamily A, polypeptide 1 Calculated Molecular Weight: 497 aa, 56 kDa Observed Molecular Weight: 50-56 kDa GenBank Accession Number: BC157063 Gene Symbol: CYP26A1 Gene ID (NCBI): 1592 RRID: AB_3669643 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O43174 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.