Proteintech, 28085-1-AP, NPC1L1 Polyclonal antibody

Size: 20ul / 150ul The NPC1L1 (28085-1-AP) by Proteintech is a Polyclonal antibody targeting NPC1L1 in WB, IHC, ELISA applications with reactivity to Human samples 28085-1-AP targets NPC1L1 in WB, IHC, ELISA applications and shows reactivity with Human samples. Tested Applications Positive WB detected in: HeLa cells, HepG2 cells Positive IHC detected in: human liver tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information NPC1 like intracellular cholesterol transporter 1 (NPC1L1) is a multi-pass membrane protein which has 1332 amino acids and containing a conserved N-terminal Niemann-Pick C1 (NPC1) domain and a putative sterol-sensing domain (SSD). It is only found in the tubular membranes of primate hepatocytes and the brush-border membranes of the small intestine of mammals. PC1L1 is a key protein for intestinal absorption of cholesterol and plays an important role in cholesterol balance. Cholesterol contributes to cell proliferation, invasion and latency, and is essential for tumor formation and growth, so NPC1L1 plays a critical role in tumor development and spread (PMID: 36034854). Specification Tested Reactivity: Human Cited Reactivity: human, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag26277 Product name: Recombinant human NPC1L1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 415-514 aa of NM_001101648 Sequence: MPNRSSYRYDSLLLGPKNFSGILDLDLLLELLELQERLRHLQVWSPEAQRNISLQDICYAPLNPDNTSLYDCCINSLLQYFQNNRTLLLLTANQTLMGQTS Predict reactive species Full Name: NPC1 (Niemann-Pick disease, type C1, gene)-like 1 Calculated Molecular Weight: 149 kDa Observed Molecular Weight: 140-149 kDa GenBank Accession Number: NM_001101648 Gene Symbol: NPC1L1 Gene ID (NCBI): 29881 RRID: AB_2918146 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9UHC9 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.