Product Description
Size: 20ul / 150ul
The ASIC3 (28093-1-AP) by Proteintech is a Polyclonal antibody targeting ASIC3 in WB, ELISA applications with reactivity to human, mouse samples
28093-1-AP targets ASIC3 in WB, ELISA applications and shows reactivity with human, mouse samples.
Tested Applications
Positive WB detected in: mouse kidney tissue
Recommended dilution
Western Blot (WB): WB : 1:500-1:2000
Specification
Tested Reactivity: human, mouse
Host / Isotype: Rabbit / IgG
Class: Polyclonal
Type: Antibody
Immunogen: CatNo: Ag26092 Product name: Recombinant human ASIC3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 107-175 aa of NM_004769 Sequence: MLHWAGSALLGLDPAEHAAFLRALGRPPAPPGFMPSPTFDMAQLYARAGHSLDDMLLDCRFRGQPCGPEN Predict reactive species
Full Name: amiloride-sensitive cation channel 3
Calculated Molecular Weight: 59 kDa
Observed Molecular Weight: 59-70 kDa
GenBank Accession Number: NM_004769
Gene Symbol: ACCN3
Gene ID (NCBI): 9311
Conjugate: Unconjugated
Form: Liquid
Purification Method: Antigen affinity purification
UNIPROT ID: Q9UHC3
Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.
Order Guidelines
1. Price & Stock Available on Request. Click to send email to: service@iright.com
2. Please DO NOT make payment before confirmation.
3. Minimum order value of $1,000 USD required.
Collaboration
Tony Tang
Email: Tony.Tang@iright.com
Mobile/WhatsApp/Wechat: +86-17717886924