Proteintech, 28100-1-AP, KL Polyclonal antibody

Size: 20ul / 150ul The KL (28100-1-AP) by Proteintech is a Polyclonal antibody targeting KL in WB, IHC, IP, ELISA applications with reactivity to human, mouse, rat samples 28100-1-AP targets KL in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse kidney tissue, rat kidney tissue Positive IP detected in: mouse kidney tissue Positive IHC detected in: human kidney tissue, mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:50-1:500 Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag27759 Product name: Recombinant human KL protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 34-184 aa of NM_004795 Sequence: MEPGDGAQTWARFSRPPAPEAAGLFQGTFPDGFLWAVGSAAYQTEGGWQQHGKGASIWDTFTHHPLAPPGDSRNASLPLGAPSPLQPATGDVASDSYNNVFRDTEALRELGVTHYRFSISWARVLPNGSAGVPNREGLRYYRRLLERLRELG Predict reactive species Full Name: klotho Calculated Molecular Weight: 116 kDa Observed Molecular Weight: 62 kDa, 130 kDa GenBank Accession Number: NM_004795 Gene Symbol: KL Gene ID (NCBI): 9365 RRID: AB_2881060 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9UEF7 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.