Proteintech, 28118-1-AP, MUC5B Polyclonal antibody

Size: 20ul / 150ul The MUC5B (28118-1-AP) by Proteintech is a Polyclonal antibody targeting MUC5B in IHC, IF-P, ELISA applications with reactivity to human, mouse samples 28118-1-AP targets MUC5B in WB, IHC, IF-P, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive IHC detected in: human lung tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-P detected in: mouse lung tissue Recommended dilution Immunohistochemistry (IHC): IHC : 1:200-1:800 Immunofluorescence (IF)-P: IF-P : 1:50-1:500 Specification Tested Reactivity: human, mouse Cited Reactivity: human, mouse, rat, pig, canine Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag27886 Product name: Recombinant human MUC5B protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 5548-5716 aa of NM_002458 Sequence: MLSGDTQDPTVQCQEDACNNTTCPQGFEYKRVAGQCCGECVQTACLTPDGQPVQLNETWVNSHVDNCTVYLCEAEGGVHLLTPQPASCPDVSSCRGSLRKTGCCYSCEEDSCQVRINTTILWHQGCETEVNITFCEGSCPGASKYSAEAQAMQHQCTCCQERRVHEETVP Predict reactive species Full Name: mucin 5B, oligomeric mucus/gel-forming Calculated Molecular Weight: 596 kDa GenBank Accession Number: NM_002458 Gene Symbol: MUC5B Gene ID (NCBI): 727897 RRID: AB_2881067 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9HC84 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.