Iright
BRAND / VENDOR: Proteintech

Proteintech, 28149-1-AP, DMRT1 Polyclonal antibody

CATALOG NUMBER: 28149-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The DMRT1 (28149-1-AP) by Proteintech is a Polyclonal antibody targeting DMRT1 in WB, IF-P, ELISA applications with reactivity to Human, mouse samples 28149-1-AP targets DMRT1 in WB, IF-P, ELISA applications and shows reactivity with Human, mouse samples. Tested Applications Positive WB detected in: A549 cells, DU 145 cells, LNCaP cells, PC-3 cells, SKOV-3 cells Positive IF-P detected in: mouse testis tissue Recommended dilution Western Blot (WB): WB : 1:500-1:3000 Immunofluorescence (IF)-P: IF-P : 1:50-1:500 Background Information DMRT1, also named DMT1, belongs to the DMRT family. DMRT1 is one of the most conserved transcription factors in a variety of species and is involved in sex determination and germ cell differentiation. DMRT1 prevents the sexual switch from male to female, represses pluripotency, and balances mitosis versus meiosis. DMRT1 also maintains spermatogenesis and replenishes mGSCs by collaborating with Plzf and Sal-like protein 4 (PMID: 33420764). DMRT1 has 3 isoforms with the molecular mass of 18, 29, and 39 kDa. Specification Tested Reactivity: Human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag28006 Product name: Recombinant human DMRT1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 119-285 aa of BC040847 Sequence: VALRRQQAQEEELGISHPIPLPSAAELLVKRENNGSNPCLMTECSGTSQPPPASVPTTAASEGRMVIQDIPAVTSRGHVENTPDLVSDSTYYSSFYQPSLFPYYNNLYNCPQYSMALAADSASGEVGNPLGGSPVKNSLRGLPGPYVPGQTGNQWQMKNMENRHAMS Predict reactive species Full Name: doublesex and mab-3 related transcription factor 1 Calculated Molecular Weight: 39 kDa Observed Molecular Weight: 39 kDa GenBank Accession Number: BC040847 Gene Symbol: DMRT1 Gene ID (NCBI): 1761 RRID: AB_2935466 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9Y5R6 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924