Product Description
Size: 20ul / 150ul
The ARGLU1 (28155-1-AP) by Proteintech is a Polyclonal antibody targeting ARGLU1 in WB, ELISA applications with reactivity to Human, mouse samples
28155-1-AP targets ARGLU1 in WB, ELISA applications and shows reactivity with Human, mouse samples.
Tested Applications
Positive WB detected in: HL-60 cells, HEK-293 cells, mouse spleen tissue
Recommended dilution
Western Blot (WB): WB : 1:1000-1:8000
Specification
Tested Reactivity: Human, mouse
Host / Isotype: Rabbit / IgG
Class: Polyclonal
Type: Antibody
Immunogen: CatNo: Ag28051 Product name: Recombinant human ARGLU1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 63-191 aa of BC071587 Sequence: TAVSRRERDRERASSPPDRIDIFGRTVSKRSSLDEKQKREEEEKKAEFERQRKIRQQEIEEKLIEEETARRVEELVAKRVEEELEKRKDEIEREVLRRVEEAKRIMEKQLLEELERQRQAELAAQKARE Predict reactive species
Full Name: arginine and glutamate rich 1
Calculated Molecular Weight: 273 aa, 33 kDa
Observed Molecular Weight: 36 kDa
GenBank Accession Number: BC071587
Gene Symbol: ARGLU1
Gene ID (NCBI): 55082
RRID: AB_2881077
Conjugate: Unconjugated
Form: Liquid
Purification Method: Antigen affinity purification
UNIPROT ID: Q9NWB6
Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.
Order Guidelines
1. Price & Stock Available on Request. Click to send email to: service@iright.com
2. Please DO NOT make payment before confirmation.
3. Minimum order value of $1,000 USD required.
Collaboration
Tony Tang
Email: Tony.Tang@iright.com
Mobile/WhatsApp/Wechat: +86-17717886924