Iright
BRAND / VENDOR: Proteintech

Proteintech, 28155-1-AP, ARGLU1 Polyclonal antibody

CATALOG NUMBER: 28155-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The ARGLU1 (28155-1-AP) by Proteintech is a Polyclonal antibody targeting ARGLU1 in WB, ELISA applications with reactivity to Human, mouse samples 28155-1-AP targets ARGLU1 in WB, ELISA applications and shows reactivity with Human, mouse samples. Tested Applications Positive WB detected in: HL-60 cells, HEK-293 cells, mouse spleen tissue Recommended dilution Western Blot (WB): WB : 1:1000-1:8000 Specification Tested Reactivity: Human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag28051 Product name: Recombinant human ARGLU1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 63-191 aa of BC071587 Sequence: TAVSRRERDRERASSPPDRIDIFGRTVSKRSSLDEKQKREEEEKKAEFERQRKIRQQEIEEKLIEEETARRVEELVAKRVEEELEKRKDEIEREVLRRVEEAKRIMEKQLLEELERQRQAELAAQKARE Predict reactive species Full Name: arginine and glutamate rich 1 Calculated Molecular Weight: 273 aa, 33 kDa Observed Molecular Weight: 36 kDa GenBank Accession Number: BC071587 Gene Symbol: ARGLU1 Gene ID (NCBI): 55082 RRID: AB_2881077 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9NWB6 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924