Iright
BRAND / VENDOR: Proteintech

Proteintech, 28175-1-AP, APH1B Polyclonal antibody

CATALOG NUMBER: 28175-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The APH1B (28175-1-AP) by Proteintech is a Polyclonal antibody targeting APH1B in WB, ELISA applications with reactivity to human, mouse, rat samples 28175-1-AP targets APH1B in WB, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: fetal human brain tissue, mouse brain tissue, rat brain tissue Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag14066 Product name: Recombinant human APH1B protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 196-257 aa of BC020905 Sequence: HLLVSAQTFISSYYGINLASAFIILVLMGTWAFLAAGGSCRSLKLCLLCQDKNFLLYNQRSR Predict reactive species Full Name: anterior pharynx defective 1 homolog B (C. elegans) Calculated Molecular Weight: 257 aa, 28 kDa Observed Molecular Weight: 30 kDa GenBank Accession Number: BC020905 Gene Symbol: APH1B Gene ID (NCBI): 83464 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q8WW43 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924