Proteintech, 28200-1-AP, IRAK2 Polyclonal antibody

Size: 20ul / 150ul The IRAK2 (28200-1-AP) by Proteintech is a Polyclonal antibody targeting IRAK2 in WB, ELISA applications with reactivity to human, mouse, rat samples 28200-1-AP targets IRAK2 in WB, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse kidney tissue, mouse spleen tissue, rat kidney tissue, rat spleen tissue Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Background Information IRAK2 (Interleukin-1 receptor-associated kinase 2) is a crucial protein involved in innate immune signaling and has diverse roles in various biological processes. IRAK2 belongs to the IRAK family of proteins, which share an N-terminal death domain (DD) that enables interactions with the DD-containing MyD88, and a central kinase domain (KD) (PMID: 24973222). IRAK2 has been implicated in various cancers. It is highly expressed in pancreatic cancer patients and is associated with poor prognosis. IRAK2 knockdown impairs pancreatic cancer cell proliferation (PMID: 37108068). Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag28179 Product name: Recombinant human IRAK2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 14-251 aa of BC125184 Sequence: DDLCRNMDALSEWDWMEFASYVITDLTQLRKIKSMERVQGVSITRELLWWWGMRQATVQQLVDLLCRLELYRAAQIILNWKPAPEIRCPIPAFPDSVKPEKPLAASVRKAEDEQEEGQPVRMATFPGPGSSPARAHQPAFLQPPEEDAPHSLRSDLPTSSDSKDFSTSIPKQEKLLSLAGDSLFWSEADVVQATDDFNQNRKISQGTFADVYRGHRHGKPFVFKKLRETACSSPGSIE Predict reactive species Full Name: interleukin-1 receptor-associated kinase 2 Calculated Molecular Weight: 625 aa, 69 kDa Observed Molecular Weight: 69 kDa GenBank Accession Number: BC125184 Gene Symbol: IRAK2 Gene ID (NCBI): 3656 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O43187 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.