Proteintech, 28203-1-AP, SPOCK1 Polyclonal antibody

Size: 20ul / 150ul The SPOCK1 (28203-1-AP) by Proteintech is a Polyclonal antibody targeting SPOCK1 in WB, IHC, ELISA applications with reactivity to human, mouse samples 28203-1-AP targets SPOCK1 in WB, IHC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: HeLa cells, PC-3 cells, DU 145 cells, mouse brain tissue, mouse stomach tissue Positive IHC detected in: human prostate cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunohistochemistry (IHC): IHC : 1:400-1:1600 Specification Tested Reactivity: human, mouse Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag28213 Product name: Recombinant human SPOCK1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 97-236 aa of BC030691 Sequence: CVTQDYQTALCVSRKHLLPRQKKGNVAQKHWVGPSNLVKCKPCPVAQSAMVCGSDGHSYTSKCKLEFHACSTGKSLATLCDGPCPCLPEPEPPKHKAERSACTDKELRNLASRLKDWFGALHEDANRVIKPTSSNTAQGR Predict reactive species Full Name: sparc/osteonectin, cwcv and kazal-like domains proteoglycan (testican) 1 Calculated Molecular Weight: 439 aa, 49 kDa Observed Molecular Weight: 49 kDa GenBank Accession Number: BC030691 Gene Symbol: SPOCK1 Gene ID (NCBI): 6695 RRID: AB_3086036 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q08629 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.