Iright
BRAND / VENDOR: Proteintech

Proteintech, 28208-1-AP, Flotillin 2 Polyclonal antibody

CATALOG NUMBER: 28208-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The Flotillin 2 (28208-1-AP) by Proteintech is a Polyclonal antibody targeting Flotillin 2 in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 28208-1-AP targets Flotillin 2 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: A375 cells, A549 cells, HEK-293 cells, HeLa cells Positive IHC detected in: human breast cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:500-1:3000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:400-1:1600 Background Information Flotillins are membrane-associated proteins that contain two homologous isoforms, flotillin 1 (FLOT1) and flotillin 2 (FLOT2). They are highly conserved and widely expressed proteins that commonly used as markers of lipid rafts. Flotillins are involved in various signaling pathways, cell adhesion, membrane trafficking and axonal growth. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag28308 Product name: Recombinant human Flotillin 2 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-379 aa of BC017292 Sequence: MTLQPRCEDVETAEGVALTVTGVAQVKIMTEKELLAVACEQFLGKNVQDIKNVVLQTLEGHLRSILGTLTVEQIYQDRDQFAKLVREVAAPDVGRMGIEILSFTIKDVYDKVDYLSSLGKTQTAVVQRDADIGVAEAERDAGIREAECKKEMLDVKFMADTKIADSKRAFELQKSAFSEEVNIKTAEAQLAYELQGAREQQKIRQEEIEIEVVQRKKQIAVEAQEILRTDKELIATVRRPAEAEAHRIQQIAEGEKVKQVLLAQAEAEKIRKIGEAEAAVIEAMGKAEAERMKLKAEAYQKYGDAAKMALVLEALPQIAAKIAAPLTKVDEIVVLSGDNSKVTSEVNRLLAELPASVHALTGVDLSKIPLIKKATGVQV Predict reactive species Full Name: flotillin 2 Calculated Molecular Weight: 379 aa, 42 kDa Observed Molecular Weight: 48 kDa GenBank Accession Number: BC017292 Gene Symbol: Flotillin 2 Gene ID (NCBI): 2319 RRID: AB_2881089 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q14254 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924