Proteintech, 28221-1-AP, HTR5A Polyclonal antibody

Size: 20ul / 150ul The HTR5A (28221-1-AP) by Proteintech is a Polyclonal antibody targeting HTR5A in IHC, ELISA applications with reactivity to Human, Mouse samples 28221-1-AP targets HTR5A in IHC, ELISA applications and shows reactivity with Human, Mouse samples. Tested Applications Positive IHC detected in: mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Immunohistochemistry (IHC): IHC : 1:50-1:500 Specification Tested Reactivity: Human, Mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag28177 Product name: Recombinant human HTR5A protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 182-282 aa of BC112021 Sequence: GETYSEGSEECQVSREPSYAVFSTVGAFYLPLCVVLFVYWKIYKAAKFRVGSRKTNSVSPISEAVEVKDSAKQPQMVFTVRHATVTFQPEGDTWREQKEQR Predict reactive species Full Name: 5-hydroxytryptamine (serotonin) receptor 5A Calculated Molecular Weight: 357 aa, 48 kDa GenBank Accession Number: BC112021 Gene Symbol: HTR5A Gene ID (NCBI): 3361 RRID: AB_2918151 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P47898 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.