Proteintech, 28268-1-AP, CTC1 Polyclonal antibody

Size: 20ul / 150ul The CTC1 (28268-1-AP) by Proteintech is a Polyclonal antibody targeting CTC1 in WB, IF-P, ELISA applications with reactivity to human samples 28268-1-AP targets CTC1 in WB, IF-P, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: A549 cells, HeLa cells, K562 cells Positive IF-P detected in: mouse brain tissue Recommended dilution Western Blot (WB): WB : 1:500-1:3000 Immunofluorescence (IF)-P: IF-P : 1:50-1:500 Background Information Conserved telomere maintenance component 1 (CTC1) is a subunit of an alpha accessory factor (AAF) that stimulates the activity of DNA polymerase-alpha-primase, the enzyme that initiates DNA replication (PMID: 19119139). CTC1 also functions in a telomere-associated complex with STN1 and TEN1 (PMID: 19854130). Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag28167 Product name: Recombinant human C17orf68 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 337-566 aa of BC111783 Sequence: PSNSEDKKDPESLVRYSRLLSYSGAVTGVLNEPAGLYELDGQLGLCLAYQQFRGLRRVMRPGVCLQLQDVHLLQSVGGGTRRPVLAPCLRGAVLLQSFSRQKPGAHSSRQAYGASLYEQLVWERQLGLPLYLWATKALEELACKLCPHVLRHHQFLQHSSPGSPSLGLQLLAPTLDLLAPPGSPVRNAHNEILEEPHHCPLQKYTRLQTPSSFPTLATLKEEGQRKAWAS Predict reactive species Full Name: chromosome 17 open reading frame 68 Calculated Molecular Weight: 1217 aa, 135 kDa Observed Molecular Weight: 135-150 kDa GenBank Accession Number: BC111783 Gene Symbol: CTC1 Gene ID (NCBI): 80169 RRID: AB_2918152 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q2NKJ3 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.