Iright
BRAND / VENDOR: Proteintech

Proteintech, 28270-1-AP, Calmodulin 1/2/3 Polyclonal antibody

CATALOG NUMBER: 28270-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The Calmodulin 1/2/3 (28270-1-AP) by Proteintech is a Polyclonal antibody targeting Calmodulin 1/2/3 in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 28270-1-AP targets Calmodulin 1/2/3 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse skeletal muscle tissue, rat skeletal muscle tissue Positive IHC detected in: rat brain tissue, mouse brain tissue, mouse skeletal muscle tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information Calmodulin is the most widely distributed and most versatile member of a family of calcium-binding proteins which probably serve as receptors for the Ca2+ signal. Through the regulation of a wide variety of intracellular enzymes, calmodulin plays a key role in many physiological processes (PMID: 6313166). Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag28000 Product name: Recombinant human CALM2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 72-149 aa of BC006464 Sequence: MMARKMKDTDSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDEEVDEMIREADIDGDGQVNYEEFVQMMTAK Predict reactive species Full Name: calmodulin 2 (phosphorylase kinase, delta) Calculated Molecular Weight: 17 kDa Observed Molecular Weight: 17-22 kDa GenBank Accession Number: BC006464 Gene Symbol: Calmodulin 1 Gene ID (NCBI): 805 RRID: AB_3669650 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P62158 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924