Iright
BRAND / VENDOR: Proteintech

Proteintech, 28272-1-AP, GLI3 Polyclonal antibody

CATALOG NUMBER: 28272-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The GLI3 (28272-1-AP) by Proteintech is a Polyclonal antibody targeting GLI3 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 28272-1-AP targets GLI3 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HepG2 cells, SKOV-3 cells Positive IHC detected in: mouse testis tissue, human colon cancer tissue, human prostate cancer tissue, rat testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunohistochemistry (IHC): IHC : 1:1000-1:4000 Background Information GLI3 belongs to the GLI C2H2-type zinc-finger protein family. GLI3 plays a role in limb and brain development. GLI3 is implicated in the transduction of SHH signal. Defects in GLI3 are the cause of Greig cephalo-poly-syndactyly syndrome (GCPS). Defects in GLI3 are a cause of Pallister-Hall syndrome (PHS). Defects in GLI3 are a cause of type A1/B postaxial polydactyly (PAPA1/PAPB). Defects in GLI3 are a cause of type IV preaxial polydactyly. Defects in GLI3 are the cause of acrocallosal syndrome (ACS). The antibody is specific to GLI3. At the molecular level, Gli3 is translated into a 190-kDa transcriptional activator (Gli3-190) that undergoes proteolytic processing into a truncated 83-kDa repressor (Gli3-83) lacking C-terminal activation domains. (PMID: 16705181) Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag28472 Product name: Recombinant human GLI3 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 641-880 aa of NM_000168 Sequence: MKQRGDIHPRPPPPRDSGSHSQSRSPGRPTQGALGEQQDLSNTTSKREECLQVKTVKAEKPMTSQPSPGGQSSCSSQQSPISNYSNSGLELPLTDGGSIGDLSAIDETPIMDSTISTATTALALQARRNPAGTKWMEHVKLERLKQVNGMFPRLNPILPPKAPAVSPLIGNGTQSNNTCSLGGPMTLLPGRSDLSGVDVTMLNMLNRRDSSASTISSAYLSSRRSSGISPCFSSRRSSEAS Predict reactive species Full Name: GLI family zinc finger 3 Calculated Molecular Weight: 170 aa Observed Molecular Weight: 170-190 kDa, 80-90 kDa GenBank Accession Number: NM_000168 Gene Symbol: GLI3 Gene ID (NCBI): 2737 RRID: AB_2881101 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P10071 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924