Iright
BRAND / VENDOR: Proteintech

Proteintech, 28356-1-AP, MTBP Polyclonal antibody

CATALOG NUMBER: 28356-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The MTBP (28356-1-AP) by Proteintech is a Polyclonal antibody targeting MTBP in WB, IHC, ELISA applications with reactivity to Human samples 28356-1-AP targets MTBP in WB, IHC, ELISA applications and shows reactivity with Human samples. Tested Applications Positive WB detected in: U2OS cells, K-562 cells Positive IHC detected in: human lung cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Specification Tested Reactivity: Human Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag28393 Product name: Recombinant human MTBP protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 98-253 aa of BC013136 Sequence: QEIHFDTEKDKIEDVLQTNIEECLGAVECFEEEDSNSRESLSLADLYEEAAENLHQLSDKLPAPGRAMVDIILLLSDKDPPKLKDYLPTVGALKHLREWYSAKITIAGNHCEINCQKIAEYLSANVVSLEDLRNVIDSKELWRGKIQIWERKFGFE Predict reactive species Full Name: Mdm2, transformed 3T3 cell double minute 2, p53 binding protein (mouse) binding protein, 104kDa Calculated Molecular Weight: 102 kDa Observed Molecular Weight: 38 kDa, 110 kDa GenBank Accession Number: BC013136 Gene Symbol: MTBP Gene ID (NCBI): 27085 RRID: AB_2881118 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q96DY7 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924