Iright
BRAND / VENDOR: Proteintech

Proteintech, 28365-1-AP, CRLF2 Polyclonal antibody

CATALOG NUMBER: 28365-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The CRLF2 (28365-1-AP) by Proteintech is a Polyclonal antibody targeting CRLF2 in WB, ELISA applications with reactivity to human samples 28365-1-AP targets CRLF2 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HepG2 cells, Jurkat cells, L02 cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Background Information Cytokine receptor-like factor 2 (CRLF2), also known as the thymic stromal derived lymphopoietin receptor (TSLPR), which in combination with the interleukin 7 receptor a chain (IL-7R) forms the receptor for thymic stromal lymphopoietin. CRLF2 is a type I cytokine receptor. CRLF2 rearrangements occur either as a translocation to the immunoglobulin heavy-chain enhancer region (IGH-CRLF2) or by a deletion of upstream PAR1 that leads to joining of CRLF2 to adjacent P2RY8. CRLF2 is expressed in heart, skeletal muscle, kidney and adult and fetal liver and is primarily expressed in dendrites and monocytes. (PMID: 20807819; 31644323; 33485429) Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag26842 Product name: Recombinant human CRLF2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 24-123 aa of NM_001012288 Sequence: MGGAAEGVQIQIIYFNLETVQVTWNASKYSRTNLTFHYRFNGDEAYDQCTNYLLQEGHTSGCLLDAEQRDDILYFSIRNGTHPVFTASRWMVYYLKPSSPK Predict reactive species Full Name: cytokine receptor-like factor 2 Calculated Molecular Weight: 42 kDa Observed Molecular Weight: 42 kDa GenBank Accession Number: NM_001012288 Gene Symbol: CRLF2 Gene ID (NCBI): 64109 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9HC73 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924