Proteintech, 28366-1-AP, BOP1 Polyclonal antibody

Size: 20ul / 150ul The BOP1 (28366-1-AP) by Proteintech is a Polyclonal antibody targeting BOP1 in WB, IHC, IF/ICC, ELISA applications with reactivity to Human, Mouse samples 28366-1-AP targets BOP1 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with Human, Mouse samples. Tested Applications Positive WB detected in: DU 145 cells, HeLa cells, NCI-H1299 cells Positive IHC detected in: human colon cancer tissue, mouse testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: PC-3 cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information Block of Proliferation 1(BOP1) protein was first isolated from a mouse, and the truncation protein may led to cell cycle arrest. Bop1 plays a role in processing of the 28S and 5.8S rRNAs (ribosomal RNAs) to regulate ribosome biogenesis. And Bop1 also act as a component of Pes1/Bop1/WDR21 (PeBoW) complex for mature 60S ribosome, and consequently acts during cell division at G1 checkpoints (PMID:18670790; PMID:26940494). What's more, abnormal expression of BOP1 was associated with liver or colorectal cancers(PMID:16804918). The molecular weight of the protein we detected was slightly higher, about 117 kd, which is also seen in the article(PMID: 30100995). Specification Tested Reactivity: Human, Mouse Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag26669 Product name: Recombinant human BOP1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-135 aa of BC013787 Sequence: MAGSRGAGRTAAPSVRPEKRRSEPELEPEPEPEPPLLCTSPLSHSTGSDSGVSDSEESVFSGLEDSGSDSSEDDDEGDEEGEDGALDDEGHSGIKKTTEEQVQASTPCPRTEMASARIGDEYAEDSSDEEDIRNT Predict reactive species Full Name: block of proliferation 1 Calculated Molecular Weight: 84 kDa Observed Molecular Weight: 117 kDa GenBank Accession Number: BC013787 Gene Symbol: BOP1 Gene ID (NCBI): 23246 RRID: AB_2881123 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q14137 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.