Proteintech, 28378-1-AP, Integrin beta-6 Polyclonal antibody

Size: 20ul / 150ul The Integrin beta-6 (28378-1-AP) by Proteintech is a Polyclonal antibody targeting Integrin beta-6 in WB, IHC, ELISA applications with reactivity to Human, Mouse samples 28378-1-AP targets Integrin beta-6 in WB, IHC, ELISA applications and shows reactivity with Human, Mouse samples. Tested Applications Positive WB detected in: A431 cells Positive IHC detected in: mouse lung tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information ITGB6 belongs to the integrin beta chain family. ITGB6 is a receptor for fibronectin and cytotactin. It recognizes the sequence R-G-D in its ligands. Internalisation of integrin alpha-V/beta-6 via clathrin-mediated endocytosis promotes carcinoma cell invasion. Specification Tested Reactivity: Human, Mouse Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag29002 Product name: Recombinant human Integrin beta-6 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 596-709 aa of BC121178 Sequence: DCVCGKCVCTNPGASGPTCERCPTCGDPCNSKRSCIECHLSAAGQAREECVDKCKLAGATISEEEDFSKDGSVSCSLQGENECLITFLITTDNEGKTIIHSINEKDCPKPPNIP Predict reactive species Full Name: integrin, beta 6 Calculated Molecular Weight: 788 aa, 86 kDa Observed Molecular Weight: 97 kDa GenBank Accession Number: BC121178 Gene Symbol: Integrin beta 6 Gene ID (NCBI): 3694 RRID: AB_2918157 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P18564 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.