Iright
BRAND / VENDOR: Proteintech

Proteintech, 28392-1-AP, TRIM3 Polyclonal antibody

CATALOG NUMBER: 28392-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The TRIM3 (28392-1-AP) by Proteintech is a Polyclonal antibody targeting TRIM3 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 28392-1-AP targets TRIM3 in WB, IHC, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse brain tissue, rat brain tissue Positive IHC detected in: human intrahepatic cholangiocarcinoma tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Immunohistochemistry (IHC): IHC : 1:250-1:1000 Background Information TRIM3, a member of the tripartite motif (TRIM) family, also called the 'RING-B-box-coiled-coil' (RBCC) subgroup of RING finger proteins. The TRIM family of genes is largely studied because of their roles in development, differentiation and host cell antiviral defenses. TRIM3 is a mammalian tumor suppressor whose loss can increase the incidence and promote the development of GBM(PMID: 23318451). TRIM3 has four isoforms with the MW of 67-80 kDa and can be detected as 75, 80, 82,85 kDa after posttranslational modification(PMID: 24947043/PMID: 24086586 ). Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag28823 Product name: Recombinant human TRIM3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 187-324 aa of NM_001248006 Sequence: SQQLQERKAEALAQISAAFEDLEQALQQRKQALVSDLETICGAKQKVLQSQLDTLRQGQEHIGSSCSFAEQALRLGSAPEVLLVRKHMRERLAALAAQAFPERPHENAQLELVLEVDGLRRSVLNLGALLTTSATAHE Predict reactive species Full Name: tripartite motif-containing 3 Calculated Molecular Weight: 81 kDa Observed Molecular Weight: 75 kDa, 80-85 kDa GenBank Accession Number: NM_001248006 Gene Symbol: TRIM3 Gene ID (NCBI): 10612 RRID: AB_2881131 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O75382 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924