Iright
BRAND / VENDOR: Proteintech

Proteintech, 28397-1-AP, TBK1 Polyclonal antibody

CATALOG NUMBER: 28397-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The TBK1 (28397-1-AP) by Proteintech is a Polyclonal antibody targeting TBK1 in WB, IHC, IF/ICC, ELISA applications with reactivity to human samples 28397-1-AP targets TBK1 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HT-1080 cells, HCT 116 cells, HeLa cells, HepG2 cells, U2OS cells Positive IHC detected in: human stomach cancer tissue, human liver cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: MCF-7 cells, HeLa cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information TBK1, also named as tumor necrosis factor (TNF) receptor-associated factor NF-kB activator (TANK)-binding kinase 1 (TBK1), NF-kB-activating kinase (NAK), T2K, is a multimeric kinase that modulates inflammation and autophagy. It is a ubiquitously expressed serine-threonine kinase belonging to the 'noncanonical IkB kinases' (IKKs) recognized for its critical role in regulating type I IFN production (PMID: 27211305). And TBK1 is an important player in yet another critical cellular function, autophagy. This antibody is specific for TBK1. Specification Tested Reactivity: human Cited Reactivity: human, mouse, rat, pig, monkey, chicken, bovine, hamster Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag28894 Product name: Recombinant human TBK1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 316-576 aa of BC034950 Sequence: LQQMTAHKIYIHSYNTATIFHELVYKQTKIISSNQELIYEGRRLVLEPGRLAQHFPKTTEENPIFVVSREPLNTIGLIYEKISLPKVHPRYDLDGDASMAKAITGVVCYACRIASTLLLYQELMRKGIRWLIELIKDDYNETVHKKTEVVITLDFCIRNIEKTVKVYEKLMKINLEAAELGEISDIHTKLLRLSSSQGTIETSLQDIDSRLSPGGSLADAWAHQEGTHPKDRNVEKLQVLLNCMTEIYYQFKKDKAERRLA Predict reactive species Full Name: TANK-binding kinase 1 Observed Molecular Weight: 84 kDa GenBank Accession Number: BC034950 Gene Symbol: TBK1 Gene ID (NCBI): 29110 RRID: AB_2881132 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9UHD2 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924