Iright
BRAND / VENDOR: Proteintech

Proteintech, 28423-1-AP, PMCA2 Polyclonal antibody

CATALOG NUMBER: 28423-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The PMCA2 (28423-1-AP) by Proteintech is a Polyclonal antibody targeting PMCA2 in WB, IHC, IF-P, ELISA applications with reactivity to Human, mouse, rat samples 28423-1-AP targets PMCA2 in WB, IHC, IF-P, ELISA applications and shows reactivity with Human, mouse, rat samples. Tested Applications Positive WB detected in: unboiled mouse brain tissue Positive IHC detected in: mouse brain tissue, rat brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-P detected in: rat brain tissue Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunohistochemistry (IHC): IHC : 1:500-1:2000 Immunofluorescence (IF)-P: IF-P : 1:50-1:500 Background Information ATP2B2, also named as PMCA2, belongs to the cation transport ATPase (P-type) family and type IIB subfamily. This magnesium-dependent enzyme catalyzes the hydrolysis of ATP coupled with the transport of calcium out of the cell. Specification Tested Reactivity: Human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag28994 Product name: Recombinant human PMCA2 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 578-782 aa of NM_001001331 Sequence: LDLKQDYEPVRSQMPEEKLYKVYTFNSVRKSMSTVIKLPDESFRMYSKGASEIVLKKCCKILNGAGEPRVFRPRDRDEMVKKVIEPMACDGLRTICVAYRDFPSSPEPDWDNENDILNELTCICVVGIEDPVRPEVPEAIRKCQRAGITVRMVTGDNINTARAIAIKCGIIHPGEDFLCLEGKEFNRRIRNEKGEIEQERIDKIW Predict reactive species Full Name: ATPase, Ca++ transporting, plasma membrane 2 Calculated Molecular Weight: 137 kDa Observed Molecular Weight: 137 kDa GenBank Accession Number: NM_001001331 Gene Symbol: PMCA2 Gene ID (NCBI): 491 RRID: AB_3086051 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q01814 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924