Proteintech, 28425-1-AP, GABRB1 Polyclonal antibody

Size: 20ul / 150ul The GABRB1 (28425-1-AP) by Proteintech is a Polyclonal antibody targeting GABRB1 in WB, ELISA applications with reactivity to Human, Mouse, Rat samples 28425-1-AP targets GABRB1 in WB, ELISA applications and shows reactivity with Human, Mouse, Rat samples. Tested Applications Positive WB detected in: mouse brain tissue, rat brain tissue Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Specification Tested Reactivity: Human, Mouse, Rat Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag29243 Product name: Recombinant human GABRB1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 26-243 aa of BC022449 Sequence: HSTNEPSNMSYVKETVDRLLKGYDIRLRPDFGGPPVDVGMRIDVASIDMVSEVNMDYTLTMYFQQSWKDKRLSYSGIPLNLTLDNRVADQLCVPDTYFLNDKKSFVHGVTVKNRMIRLHPDGTVLYGLRITTTAACMMDLRRYPLDEQNCTLEIESYGYTTDDIEFYWNGGEGAVTGVNKIELPQFSIVDYKMVSKKVEFTTGAYPRLSLSFRLKRNI Predict reactive species Full Name: gamma-aminobutyric acid (GABA) A receptor, beta 1 Calculated Molecular Weight: 474 aa, 54 kDa Observed Molecular Weight: 50-54 kDa GenBank Accession Number: BC022449 Gene Symbol: GABRB1 Gene ID (NCBI): 2560 RRID: AB_2881139 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P18505 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.