Proteintech, 28434-1-AP, SETD5 Polyclonal antibody

Size: 20ul / 150ul The SETD5 (28434-1-AP) by Proteintech is a Polyclonal antibody targeting SETD5 in WB, IP, ELISA applications with reactivity to human samples 28434-1-AP targets SETD5 in WB, IP, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HEK-293T cells Positive IP detected in: BxPC-3 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Background Information SETD5, also known as KIAA1757, is a member of the histone lysine methyltransferase family. It has 3 isoforms and is involved in a variety of cellular functions, including cell cycle regulation and cell proliferation, and has a potential role in early embryonic development (PMID: 36875494). Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag28920 Product name: Recombinant human SETD5 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-202 aa of BC020956 Sequence: MHAFENLEKRKKRRDQPLEQSNSDVEITTTTSETPVGEETKTEAPESEVSNSVSNVTIPSTPQSVGVNTRRSSQAGDIAAEKLVPKPPPAKPSRPRPKSRISRYRTSSAQRLKRQKQANAQQAELSQAALEEGGSNSLVTPTEAGSLDSSGENRPLTGSDPTVVSITGSHVNRAASKYPKTKKYLVTEWLNDKAEKQECPVE Predict reactive species Full Name: SET domain containing 5 Observed Molecular Weight: 160-220 kDa GenBank Accession Number: BC020956 Gene Symbol: SETD5 Gene ID (NCBI): 55209 RRID: AB_3669659 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9C0A6 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.