Iright
BRAND / VENDOR: Proteintech

Proteintech, 28437-1-AP, KMT2C Polyclonal antibody

CATALOG NUMBER: 28437-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The KMT2C (28437-1-AP) by Proteintech is a Polyclonal antibody targeting KMT2C in WB, IHC, ELISA applications with reactivity to human samples 28437-1-AP targets KMT2C in WB, IHC, IF, CoIP, ChIP, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: K-562 cells Positive IHC detected in: human ovary cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunohistochemistry (IHC): IHC : 1:200-1:800 Background Information Lysine (K)-specific methyltransferase 2C (KMT2C, also known as MLL3) belongs to the mixed-lineage leukemia (MLL) family of histone methyltransferases which methylate the histone 3 tail at lysine 4 (H3K4) as part of the complex proteins associated with Set 1 (COMPASS) complex. Although originally identified as oncogenic fusions in leukemia, genome-wide mutation studies have revealed frequent, presumably loss-of-function, mutations in various members of the MLL family, including MLL2/KMT2B, MLL3/KMT2C, and MLL4/KMT2D in a variety of malignancies, particularly solid tumors. Mechanistic studies of KMT2C in normal cells have focused primarily on its role in enhancer regulation by deposition of H3K4me1 marks. Specification Tested Reactivity: human Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag28875 Product name: Recombinant human KMT2C protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 2771-3000 aa of NM_170606 Sequence: SMFNEELDLPIDDKLDNQCVSVEPKKKEQENKTLVLSDKHSPQKKSTVTNEVKTEVLSPNSKVESKCETEKNDENKDNVDTPCSQASAHSDLNDGEKTSLHPCDPDLFEKRTNRETAGPSANVIQASTQLPAQDVINSCGITGSTPVLSSLLANEKSDNSDIRPSGSPPPPTLPASPSNHVSSLPPFIAPPGRVLDNAMNSNVTVVSRVNHVFSQGVQVNPGLIPGQSTV Predict reactive species Full Name: myeloid/lymphoid or mixed-lineage leukemia 3 Calculated Molecular Weight: 541 kDa Observed Molecular Weight: 541kDa, 269 kDa GenBank Accession Number: NM_170606 Gene Symbol: KMT2C Gene ID (NCBI): 58508 RRID: AB_2918165 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q8NEZ4 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924