Proteintech, 28455-1-AP, IL-15 Polyclonal antibody

Size: 20ul / 150ul The IL-15 (28455-1-AP) by Proteintech is a Polyclonal antibody targeting IL-15 in IHC, ELISA applications with reactivity to Human samples 28455-1-AP targets IL-15 in IHC, IF, ELISA applications and shows reactivity with Human samples. Tested Applications Positive IHC detected in: human tonsillitis tissue, human small intestine tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Immunohistochemistry (IHC): IHC : 1:50-1:500 Specification Tested Reactivity: Human Cited Reactivity: mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag29395 Product name: Recombinant human IL-15 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 50-111 aa of BC018149 Sequence: WVNVISDLKKIEDLIQSMHIDATLYTESDVHPSCKVTAMKCFLLELQVISLESGDASIHDTV Predict reactive species Full Name: interleukin 15 Calculated Molecular Weight: 18 kDa GenBank Accession Number: BC018149 Gene Symbol: IL15 Gene ID (NCBI): 3600 RRID: AB_2881146 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P40933 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.